ARG41315
anti-SEC63 antibody
anti-SEC63 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SEC63 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SEC63 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the C-terminal region of Human SEC63. (within the following region: WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS) |
| Conjugation | Un-conjugated |
| Alternate Names | DNAJC23; SEC63L; PRO2507; ERdj2; Translocation protein SEC63 homolog |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | HepG2 |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9UGP8 Human Translocation protein SEC63 homolog |
|---|---|
| Gene Symbol | SEC63 |
| Gene Full Name | SEC63 homolog, protein translocation regulator |
| Background | The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq, Jul 2008] |
| Function | Required for integral membrane and secreted preprotein translocation across the endoplasmic reticulum membrane. [UniProt] |
| Cellular Localization | Endoplasmic reticulum membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 88 kDa |
