ARG59549
anti-SFTPA1 + SFTPA2 antibody
anti-SFTPA1 + SFTPA2 antibody for IHC-Formalin-fixed paraffin-embedded sections,IHC-Frozen sections and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SFTPA1 + SFTPA2 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-Fr, IHC-P |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SFTPA1 + SFTPA2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 206-237 of Human SFTPA1/2. (VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN) |
| Conjugation | Un-conjugated |
| Alternate Names | SFTPA1B; SP-A; COLEC4; Pulmonary surfactant-associated protein A1; PSAP; PSPA; 35 kDa pulmonary surfactant-associated protein; SFTP1; PSP-A; SPA; SPA1; Alveolar proteinosis protein; SP-A1; Collectin-4; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P08427 Rat Pulmonary surfactant-associated protein A Swiss-port # Q8IWL2 Human Pulmonary surfactant-associated protein A1 |
|---|---|
| Gene Symbol | SFTPA1; SFTPA2 |
| Gene Full Name | surfactant protein A1; surfactant protein A2 |
| Background | This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Function | In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. [UniProt] |
| Cellular Localization | Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film. [UniProt] |
| Calculated MW | SFTPA1 and SFTPA2: 26 kDa |
| PTM | N-acetylated. [UniProt] |
