ARG59225
anti-SMC3 antibody
anti-SMC3 antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SMC3 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Bov, Chk, Hrs, Mk, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SMC3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 1178-1216 of Human SMC3. (ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH) |
| Conjugation | Un-conjugated |
| Alternate Names | CDLS3; CSPG6; SMC3L1; SMC-3; Chromosome-associated polypeptide; BMH; Basement membrane-associated chondroitin proteoglycan; Structural maintenance of chromosomes protein 3; Bamacan; hCAP; Chondroitin sulfate proteoglycan 6; SMC protein 3; HCAP; BAM |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9CW03 Mouse Structural maintenance of chromosomes protein 3 Swiss-port # Q9UQE7 Human Structural maintenance of chromosomes protein 3 |
|---|---|
| Gene Symbol | SMC3 |
| Gene Full Name | structural maintenance of chromosomes 3 |
| Background | This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. [provided by RefSeq, Jul 2008] |
| Function | Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement. [UniProt] |
| Cellular Localization | Nucleus. Chromosome. Chromosome, centromere. Note=Associates with chromatin. [UniProt] |
| Calculated MW | 142 kDa |
| PTM | Phosphorylated at Ser-1083 in a SPO11-dependent manner. Acetylation at Lys-105 and Lys-106 by ESCO1 is important for genome stability and S phase sister chromatid cohesion. Regulated by DSCC1, it is required for processive DNA synthesis, coupling sister chromatid cohesion establishment during S phase to DNA replication. Deacetylation by HDAC8, regulates release of the cohesin complex from chromatin. [UniProt] |
