ARG43064

anti-SORBS3 / Vinexin antibody

anti-SORBS3 / Vinexin antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes SORBS3 / Vinexin
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, ICC/IF, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name SORBS3 / Vinexin
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human SORBS3 / Vinexin. (ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE)
Conjugation Un-conjugated
Alternate Names SH3-containing adapter molecule 1; Sorbin and SH3 domain-containing protein 3; SCAM-1; Vinexin; SCAM1; SH3D4

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0).
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 10174 Human SORBS3

GeneID: 20410 Mouse SORBS3

Swiss-port # O60504 Human Vinexin

Swiss-port # Q9R1Z8 Mouse Vinexin

Gene Symbol SORBS3
Gene Full Name sorbin and SH3 domain containing 3
Background This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Function Vinexin alpha isoform promotes up-regulation of actin stress fiber formation. Vinexin beta isoform plays a role in cell spreading and enhances the activation of JNK/SAPK in response to EGF stimulation by using its third SH3 domain. [UniProt]
Cellular Localization Isoform Alpha: Cell junction. Cytoplasm, cytoskeleton. Note=Localized at cell-extracellular matrix junctions (By similarity). Both isoforms were localized at focal adhesion and cell-cell adhesion sites. Isoform Beta: Cell junction. Nucleus. Cytoplasm, cytoskeleton. Note=Localized at cell-extracellular matrix junctions (By similarity). Both isoforms were localized at focal adhesion and cell-cell adhesion sites, vinexin beta was also found in the nucleus. [UniProt]
Calculated MW 75 kDa
PTM Phosphorylated at Ser-530 by MAPK1/ERK2 during cell spreading. [UniProt]