ARG59127

anti-SOX5 antibody

anti-SOX5 antibody for Western blot and Human,Mouse,Rat,Pig

Overview

Product Description Rabbit Polyclonal antibody recognizes SOX5
Tested Reactivity Hu, Ms, Rat, Pig
Predict Reactivity Bov
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name SOX5
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 495-528 of Human SOX5. (EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS)
Conjugation Un-conjugated
Alternate Names L-SOX5B; L-SOX5; Transcription factor SOX-5; L-SOX5F

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 20678 Mouse SOX5

GeneID: 6660 Human SOX5

Swiss-port # P35710 Mouse Transcription factor SOX-5

Swiss-port # P35711 Human Transcription factor SOX-5

Gene Symbol SOX5
Gene Full Name SRY (sex determining region Y)-box 5
Background This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Function Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 84 kDa