ARG59130

anti-SP2 antibody

anti-SP2 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes SP2
Tested Reactivity Hu, Rat
Predict Reactivity Hm
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name SP2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 312-343 of Human SP2. (QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ)
Conjugation Un-conjugated
Alternate Names Transcription factor Sp2

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 6668 Human SP2

Swiss-port # Q02086 Human Transcription factor Sp2

Gene Symbol SP2
Gene Full Name Sp2 transcription factor
Background This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. [provided by RefSeq, Jul 2008]
Function Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 65 kDa