ARG40763
anti-STAT2 antibody
anti-STAT2 antibody for Western blot and Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes STAT2 |
|---|---|
| Tested Reactivity | Ms, Rat |
| Predict Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | STAT2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human STAT2. (FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA) |
| Conjugation | Un-conjugated |
| Alternate Names | P113; Signal transducer and activator of transcription 2; STAT113; p113; ISGF-3 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | STAT2 |
| Gene Full Name | signal transducer and activator of transcription 2, 113kDa |
| Background | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
| Function | Signal transducer and activator of transcription that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. Note=Translocated into the nucleus upon activation by IFN-alpha/beta. [UniProt] |
| Highlight | Related products: STAT2 antibodies; Anti-Rabbit IgG secondary antibodies; Related news: Exploring Antiviral Immune Response circNDUFB2, a circular RNA (circRNA), activates anti-tumor immunity |
| Calculated MW | 98 kDa |
| PTM | Tyrosine phosphorylated in response to IFN-alpha. Phosphorylation at Ser-287 negatively regulates the transcriptional response. [UniProt] |
