ARG40778

anti-TRPM2 antibody

anti-TRPM2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes TRPM2
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name TRPM2
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human TRPM2. (Within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK)
Conjugation Un-conjugated
Alternate Names KNP3; Transient receptor potential cation channel subfamily M member 2; NUDT9H; EREG1; LTrpC2; TrpC7; EC 3.6.1.13; TRPC7; NUDT9L1; LTRPC2; LTrpC-2; Transient receptor potential channel 7; Long transient receptor potential channel 2; Estrogen-responsive element-associated gene 1 protein

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea pig: 88%; Horse: 93%; Mouse: 100%; Rat: 100%
Application Suggestion
Tested Application Dilution
IHC-P10 µg/ml
WB0.5 - 1 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 7226 Human TRPM2

Swiss-port # O94759 Human Transient receptor potential cation channel subfamily M member 2

Gene Symbol TRPM2
Gene Full Name transient receptor potential cation channel, subfamily M, member 2
Background The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jul 2008]
Function Nonselective, voltage-independent cation channel mediating sodium and calcium ion influx in response to oxidative stress. Extracellular calcium passes through the channel and acts from the intracellular side as a positive regulator in channel activation. Activated by ADP-ribose, nicotinamide adenine dinucleotide (NAD(+)), reactive nitrogen species and arachidonic acid. Inactivated by intracellular ATP. Confers susceptibility to cell death following oxidative stress. Isoform 2 does not seem to be regulated by ADPR. Has ADP-ribose pyrophosphatase activity. [UniProt]
Cellular Localization Isoform 1,2 and 3: Cell membrane; Multi-pass membrane protein. Note=Detected at the cell membrane and in intracellular vesicles in cortical neurons. Detected on neuronal cell bodies and neurites. Detected on the cell membrane in polymorphonuclear neutrophils. Detected on cytoplasmic vesicles and lysosomes in immature bone marrow dendritic cells. [UniProt]
Calculated MW 171 kDa