ARG43088

anti-UPF3B antibody

anti-UPF3B antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes UPF3B
Tested Reactivity Hu, Rat
Predict Reactivity Ms, Bov
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name UPF3B
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 416-452 of Human UPF3B. (SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL)
Conjugation Un-conjugated
Alternate Names Nonsense mRNA reducing factor 3B; UPF3X; RENT3B; HUPF3B; Regulator of nonsense transcripts 3B; Up-frameshift suppressor 3 homolog on chromosome X; Up-frameshift suppressor 3 homolog B; hUpf3p-X; MRXS14; hUpf3B; MRX62

Application Instructions

Application Suggestion
Tested Application Dilution
WB1:500 - 1:2000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 58 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 65109 Human UPF3B

Swiss-port # Q9BZI7 Human Regulator of nonsense transcripts 3B

Gene Symbol UPF3B
Gene Full Name UPF3 regulator of nonsense transcripts homolog B (yeast)
Background This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Function Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2-UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF2 stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA upstream of exon-exon junctions. In vitro, stimulates translation; the function is independent of association with UPF2 and components of the EJC core. [UniProt]
Cellular Localization Nucleus. Cytoplasm. Note=Shuttling between the nucleus and the cytoplasm. [UniProt]
Calculated MW 58 kDa