ARG41733
anti-Wnt7a antibody
anti-Wnt7a antibody for Flow cytometry,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Wnt7a |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Bov |
| Tested Application | FACS, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Wnt7a |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 226-256 of Human Wnt7a. (YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK) |
| Conjugation | Un-conjugated |
| Alternate Names | Protein Wnt-7a |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Observed Size | ~ 39 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl and 4% Trehalose. |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | WNT7A |
| Gene Full Name | wingless-type MMTV integration site family, member 7A |
| Background | This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi/Raas-Rothschild/Schinzel phocomelia syndromes. [provided by RefSeq, Jul 2008] |
| Function | Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. Signaling by Wnt-7a allows sexually dimorphic development of the mullerian ducts (By similarity). [UniProt] |
| Cellular Localization | Secreted, extracellular space, extracellular matrix. Secreted. [UniProt] |
| Calculated MW | 39 kDa |
| PTM | Palmitoleylation is required for efficient binding to frizzled receptors. Depalmitoleylation leads to Wnt signaling pathway inhibition. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG41733 anti-Wnt7a antibody WB image
Western blot: Rat kidney, Rat liver ,Mouse kidney stained with ARG41733 anti-Wnt7a antibody at 1:1000 dilution.
-
ARG41733 anti-Wnt7a antibody FACS image
Flow Cytometry: PC-3 cells stained with ARG10766 anti-ABCB4 / MDR3 antibody ARG41733 anti-Wnt7a antibody at 1:500 dilution / 1x10^6 cells.
