ARG59230

anti-ZP2 antibody

anti-ZP2 antibody for IHC-Frozen sections,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes ZP2
Tested Reactivity Hu
Predict Reactivity Ms, Rat
Tested Application IHC-Fr, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ZP2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 511-544 of Human ZP2. (ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD)
Conjugation Un-conjugated
Alternate Names ZPA; Zona pellucida glycoprotein 2; Zp-2; Zona pellucida sperm-binding protein 2; Zona pellucida protein A

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-Fr0.5 - 1 µg/ml
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 7783 Human ZP2

Swiss-port # Q05996 Human Zona pellucida sperm-binding protein 2

Gene Symbol ZP2
Gene Full Name zona pellucida glycoprotein 2 (sperm receptor)
Background The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Function The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor. [UniProt]
Cellular Localization Processed zona pellucida sperm-binding protein 2: Secreted, extracellular space, extracellular matrix. Note=The glycoproteinaceous translucent extracellular matrix that surrounds the mammalian oocyte is called zona pellucida. Cell membrane; Single-pass type I membrane protein. [UniProt]
Calculated MW 82 kDa
PTM Proteolytically cleaved before the transmembrane segment to yield the secreted ectodomain incorporated in the zona pellucida.

Proteolytically cleaved in the N-terminal part by the metalloendopeptidase ASTL exocytosed from cortical granules after fertilization, yielding a N-terminal peptide of about 30 kDa which remains covalently attached to the C-terminal peptide via disulfide bond(s). This cleavage may play an important role in the post-fertilization block to polyspermy. Additional proteolytically cleavage of the N-terminal peptide of 30 kDa occurs in one-cell and two-cell embryos.

N-glycosylated.

O-glycosylated; contains sulfate-substituted glycans. [UniProt]