ARG58612
anti-eRF1 antibody
anti-eRF1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes eRF1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Yeast, Zfsh |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | eRF1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human eRF1. (within the following sequence: ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL) |
| Conjugation | Un-conjugated |
| Alternate Names | Protein Cl1; RF1; eRF1; ERF1; Eukaryotic release factor 1; Eukaryotic peptide chain release factor subunit 1; ERF; TB3-1; SUP45L1; D5S1995 |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | THP-1 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P62495 Human Eukaryotic peptide chain release factor subunit 1 |
|---|---|
| Gene Symbol | ETF1 |
| Gene Full Name | eukaryotic translation termination factor 1 |
| Background | This gene encodes a class-1 polypeptide chain release factor. The encoded protein plays an essential role in directing termination of mRNA translation from the termination codons UAA, UAG and UGA. This protein is a component of the SURF complex which promotes degradation of prematurely terminated mRNAs via the mechanism of nonsense-mediated mRNA decay (NMD). Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 6, 7, and X. [provided by RefSeq, Aug 2013] |
| Function | Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. [UniProt] |
| Calculated MW | 49 kDa |
