ARG41271
anti-ACTR1A / ARP1 antibody
anti-ACTR1A / ARP1 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes ACTR1A / ARP1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | ACTR1A / ARP1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human ACTR1A / ARP1. (within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP) |
| Conjugation | Un-conjugated |
| Alternate Names | Alpha-centractin; Actin-RPV; Arp1A; Centractin; Centrosome-associated actin homolog; CTRN1; ARP1 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | MCF7 | ||||
| Observed Size | 43 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ACTR1A |
| Gene Full Name | ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) |
| Background | This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. [provided by RefSeq, Jul 2008] |
| Function | Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome. [UniProt] |
| Cellular Localization | Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cell cortex. [UniProt] |
| Calculated MW | 43 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41271 anti-ACTR1A / ARP1 antibody WB image
Western blot: MCF7 cell lysate stained with ARG41271 anti-ACTR1A / ARP1 antibody at 0.2 - 1 µg/ml dilution.
