ARG59212
anti-CCDC6 antibody
anti-CCDC6 antibody for Flow cytometry,ICC/IF,Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CCDC6 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Predict Reactivity | Bov, Chk, Dog, Hm, Hrs, Mk, Rb, Zfsh |
| Tested Application | FACS, ICC/IF, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CCDC6 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 156-198 of Human CCDC6. (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) |
| Conjugation | Un-conjugated |
| Alternate Names | TPC; PTC; D10S170; H4; Papillary thyroid carcinoma-encoded protein; Coiled-coil domain-containing protein 6; Protein H4; TST1 |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q16204 Human Coiled-coil domain-containing protein 6 |
|---|---|
| Gene Symbol | CCDC6 |
| Gene Full Name | coiled-coil domain containing 6 |
| Background | This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.[provided by RefSeq, Sep 2010] |
| Cellular Localization | Cytoplasm. Cytoplasm, cytoskeleton. Note=May be a cytoskeletal protein. [UniProt] |
| Calculated MW | 53 kDa |
Images (3) Click the Picture to Zoom In
-
ARG59212 anti-CCDC6 antibody ICC/IF image
Immunofluorescence: T-47D cells were blocked with 10% goat serum and then stained with ARG59212 anti-CCDC6 antibody (green) at 5 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59212 anti-CCDC6 antibody WB image
Western blot: Rat testis and MCF-7 whole cell lysate stained with ARG59212 anti-CCDC6 antibody at 0.5 µg/ml dilution.
-
ARG59212 anti-CCDC6 antibody FACS image
Flow Cytometry: Caco-2 cells were blocked with 10% normal goat serum and then stained with ARG59212 anti-CCDC6 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
