ARG59304
anti-CEP68 antibody
anti-CEP68 antibody for Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes CEP68 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | CEP68 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to a sequence of Human CEP68. (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID) |
Conjugation | Un-conjugated |
Alternate Names | Cep68; Centrosomal protein of 68 kDa; KIAA0582 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
Preservative | 0.05% Sodium azide |
Stabilizer | 4% Trehalose |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | CEP68 |
Gene Full Name | centrosomal protein 68kDa |
Cellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Localizes to thin fibers protruding away from the proximal ends of the two centrioles. Dissociates from interphase centrosomes at the onset of mitosis. [UniProt] |
Calculated MW | 81 kDa |
PTM | Phosphorylation by PLK1 is required for binding to BTRC in prometaphase (PubMed:25503564). Phosphorylated directly or indirectly by NEK2 (PubMed:24554434). NEK2-mediated phosphorylation promotes CEP68 dissociation from the centrosome and its degradation at the onset of mitosis (PubMed:25704143). Ubiquitinated and targeted for proteasomal degradation in early mitosis by the SCF(BTRC) and/or SCF(FBXW11) E3 ubiquitin-protein ligase complexes (PubMed:25704143, PubMed:25503564). Degradation is complete by prometaphase and is required for removal of CDK5RAP2 from the peripheral pericentriolar material and subsequent centriole separation (PubMed:25503564). [UniProt] |
Images (1) Click the Picture to Zoom In