ARG40417

anti-GCM1 antibody

anti-GCM1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes GCM1
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Dog
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GCM1
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human GCM1 (within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK).
Conjugation Un-conjugated
Alternate Names GCMA; hGCMa; Glial cells missing homolog 1; Chorion-specific transcription factor GCMa; GCM motif protein 1

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Mouse: 78%; Rat: 78%; Dog: 78%
Application Suggestion
Tested Application Dilution
IHC-PAssay-dependent
WB1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 53 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 8521 Human GCM1

Swiss-port # Q9NP62 Human Chorion-specific transcription factor GCMa

Gene Symbol GCM1
Gene Full Name glial cells missing homolog 1 (Drosophila)
Background This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq, Jul 2008]
Function Transcription factor that is necessary for placental development. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 49 kDa
PTM Polyubiquitinated in the presence of UBE2D2 and FBXW2 (in vitro). [UniProt]

Images (3) Click the Picture to Zoom In

  • ARG40417 anti-GCM1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human spleen tissue stained with ARG40417 anti-GCM1 antibody.

  • ARG40417 anti-GCM1 antibody WB image

    Western blot: 293T cell lysate stained with ARG40417 anti-GCM1 antibody at 1 µg/ml dilution.

  • ARG40417 anti-GCM1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung tissue stained with ARG40417 anti-GCM1 antibody.