ARG43047
anti-LRIG1 antibody
anti-LRIG1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes LRIG1 |
---|---|
Tested Reactivity | Hu |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | LRIG1 |
Antigen Species | Mouse |
Immunogen | Synthetic peptide corresponding to a sequence of mouse LRIG1. (AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI) |
Conjugation | Un-conjugated |
Alternate Names | LIG-1; LIG1; Leucine-rich repeats and immunoglobulin-like domains protein 1 |
Application Instructions
Application Suggestion |
|
||||||
---|---|---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
Preservative | 0.05% Sodium azide |
Stabilizer | 4% Trehalose |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q96JA1 Human Leucine-rich repeats and immunoglobulin-like domains protein 1 |
---|---|
Gene Symbol | LRIG1 |
Gene Full Name | leucine-rich repeats and immunoglobulin-like domains 1 |
Function | Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation. [UniProt] |
Cellular Localization | Cell membrane; Single-pass type I membrane protein. [UniProt] |
Calculated MW | 119 kDa |
Images (2) Click the Picture to Zoom In
-
ARG43047 anti-LRIG1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43047 anti-LRIG1 antibody at 2 µg/ml dilution, overnight at 4°C.
-
ARG43047 anti-LRIG1 antibody WB image
Western blot: 50 µg of sample under reducing conditions. Caco-2 whole cell lysate stained with ARG43047 anti-LRIG1 antibody at 0.5 µg/ml dilution, overnight at 4°C.