ARG40150
anti-REXO4 / PMC2 antibody
anti-REXO4 / PMC2 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes REXO4 / PMC2 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | REXO4 / PMC2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human REXO4 / PMC2. (within the following region: PADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEM) |
| Conjugation | Un-conjugated |
| Alternate Names | RNA exonuclease 4; hPMC2; Prevents mitotic catastrophe 2 protein homolog; XPMC2H; Exonuclease XPMC2; EC 3.1.-.-; REX4; XPMC2 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human lung |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | REXO4 |
| Gene Full Name | REX4 homolog, 3'-5' exonuclease |
| Cellular Localization | Nucleus, nucleolus. [UniProt] |
| Calculated MW | 47 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40150 anti-REXO4 / PMC2 antibody WB image
Western blot: Human lung lysate stained with ARG40150 anti-REXO4 / PMC2 antibody at 0.2 - 1 µg/ml dilution.
