ARG42948

anti-Relaxin 1 antibody

anti-Relaxin 1 antibody for IHC-Formalin-fixed paraffin-embedded sections and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes Relaxin 1
Tested Reactivity Hu
Tested Application IHC-P
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Relaxin 1
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human Relaxin 1. (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS)
Conjugation Un-conjugated
Alternate Names bA12D24.3.1; bA12D24.3.2; Prorelaxin H1; RLXH1; H1; H1RLX

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 6013 Human RLN1

Swiss-port # P04808 Human Prorelaxin H1

Gene Symbol RLN1
Gene Full Name relaxin 1
Background Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In humans there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3, where RLN1 and RLN2 share high sequence homology. The protein encoded by this gene is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. [provided by RefSeq, Jan 2013]
Function Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 21 kDa

Images (3) Click the Picture to Zoom In

  • ARG42948 anti-Relaxin 1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42948 anti-Relaxin 1 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG42948 anti-Relaxin 1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human prostatic cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42948 anti-Relaxin 1 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG42948 anti-Relaxin 1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human colon cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42948 anti-Relaxin 1 antibody at 1 µg/ml dilution, overnight at 4°C.