ARG40154
anti-SERPINB13 antibody
anti-SERPINB13 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SERPINB13 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SERPINB13 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human SERPINB13. (within the following region: RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT) |
| Conjugation | Un-conjugated |
| Alternate Names | Peptidase inhibitor 13; headpin; HaCaT UV-repressible serpin; Hurpin; Proteinase inhibitor 13; HUR7; HSHUR7SEQ; Serpin B13; PI13; Headpin; PI-13 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | COLO205 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SERPINB13 |
| Gene Full Name | serpin peptidase inhibitor, clade B (ovalbumin), member 13 |
| Function | May play a role in the proliferation or differentiation of keratinocytes. [UniProt] |
| Cellular Localization | Cytoplasm. [UniProt] |
| Calculated MW | 44 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40154 anti-SERPINB13 antibody WB image
Western blot: COLO205 cell lysate stained with ARG40154 anti-SERPINB13 antibody at 0.2 - 1 µg/ml dilution.
