ARG41690
anti-SLC15A2 / PepT2 antibody
anti-SLC15A2 / PepT2 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SLC15A2 / PepT2 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SLC15A2 / PepT2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human SLC15A2 / PepT2. (within the following region: GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV) |
| Conjugation | Un-conjugated |
| Alternate Names | Kidney H; Solute carrier family 15 member 2; Oligopeptide transporter, kidney isoform; PEPT2; Peptide transporter 2 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 86%; Dog: 83%; Guinea pig: 79%; Horse: 93%; Mouse: 79%; Pig: 86%; Rabbit: 93%; Rat: 79% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | MCF7 | ||||
| Observed Size | ~ 90 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SLC15A2 |
| Gene Full Name | solute carrier family 15 (oligopeptide transporter), member 2 |
| Background | The mammalian kidney expresses a proton-coupled peptide transporter that is responsible for the absorption of small peptides, as well as beta-lactam antibiotics and other peptide-like drugs, from the tubular filtrate. This transporter, SLC15A2, belongs to the same gene family as SLC15A1 (MIM 600544), the proton-coupled peptide transporter found in the small intestine (Liu et al, 1995 [PubMed 7756356]).[supplied by OMIM, Feb 2011] |
| Function | Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. [UniProt] |
| Cellular Localization | Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 82 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41690 anti-SLC15A2 / PepT2 antibody WB image
Western blot: MCF7 cell lysate stained with ARG41690 anti-SLC15A2 / PepT2 antibody at 0.2 - 1 µg/ml dilution.
