ARG59646
anti-TFIIE beta antibody
anti-TFIIE beta antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes TFIIE beta |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat, Cow, Dog, Goat, Gpig, Hrs, Rb, Zfsh |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | TFIIE beta |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human TFIIE beta. (within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG) |
Conjugation | Un-conjugated |
Alternate Names | General transcription factor IIE subunit 2; TF2E2; TFIIE-beta; FE; Transcription initiation factor IIE subunit beta; TFIIE-B |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% | ||||||
---|---|---|---|---|---|---|---|
Application Suggestion |
|
||||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # P29084 Human Transcription initiation factor IIE subunit beta |
---|---|
Gene Symbol | GTF2E2 |
Gene Full Name | general transcription factor IIE, polypeptide 2, beta 34kDa |
Function | Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase. [UniProt] |
Cellular Localization | Nucleus. [UniProt] |
Calculated MW | 33 kDa |
Images (2) Click the Picture to Zoom In
-
ARG59646 anti-TFIIE beta antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human cardiac cell (epithelial cells of renal tubule) stained with ARG59646 anti-TFIIE beta antibody at 4 - 8 µg/ml dilution. (Magnification: 400X).
-
ARG59646 anti-TFIIE beta antibody WB image
Western blot: Daudi cell lysate stained with ARG59646 anti-TFIIE beta antibody at 0.2 - 1 µg/ml dilution.